PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00040693-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 48aa    MW: 5716.4 Da    PI: 4.4015
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00040693-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.31e-09240343
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43
                       ++++E++l+ ++ ++lG + W++Ia +++ gRt  ++  +
  PSME_00040693-RA  2 DFSEDEEDLISRLYNLLGQR-WDLIAGRIP-GRTVDEIEKY 40
                      59*****************9.*********.***9998766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.278148IPR017930Myb domain
PfamPF002497.0E-9240IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-11340IPR009057Homeodomain-like
SuperFamilySSF466891.95E-7341IPR009057Homeodomain-like
CDDcd001674.50E-6341No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 48 aa     Download sequence    Send to blast
MDFSEDEEDL ISRLYNLLGQ RWDLIAGRIP GRTVDEIEKY CSKRYASY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0821221e-59EF082122.1 Picea sitchensis clone WS02813_H08 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009417220.12e-20PREDICTED: MYB-like transcription factor ETC1 isoform X1
RefseqXP_009417221.12e-20PREDICTED: MYB-like transcription factor ETC1 isoform X2
SwissprotO220599e-16CPC_ARATH; Transcription factor CPC
TrEMBLA9NLI81e-25A9NLI8_PICSI; Putative uncharacterized protein
STRINGGSMUA_Achr10P09220_0019e-19(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.15e-17MYB_related family protein